Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 1828927..1829486 | Replicon | chromosome |
| Accession | NZ_CP097186 | ||
| Organism | Rhodococcus sp. GA1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3330_RS08510 | Protein ID | WP_024102981.1 |
| Coordinates | 1828927..1829205 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3330_RS08515 | Protein ID | WP_024102980.1 |
| Coordinates | 1829202..1829486 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3330_RS08480 | 1824045..1824764 | + | 720 | WP_255028465.1 | 2OG-Fe(II) oxygenase | - |
| M3330_RS08485 | 1824801..1825772 | - | 972 | WP_006551850.1 | phosphotriesterase | - |
| M3330_RS08490 | 1825817..1826647 | - | 831 | WP_006551851.1 | SDR family oxidoreductase | - |
| M3330_RS08495 | 1826768..1827430 | + | 663 | WP_255028468.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| M3330_RS08500 | 1827580..1828332 | + | 753 | WP_064060432.1 | cutinase family protein | - |
| M3330_RS08505 | 1828391..1828870 | + | 480 | WP_006551854.1 | MarR family transcriptional regulator | - |
| M3330_RS08510 | 1828927..1829205 | - | 279 | WP_024102981.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3330_RS08515 | 1829202..1829486 | - | 285 | WP_024102980.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M3330_RS08520 | 1829708..1830526 | - | 819 | WP_006551857.1 | family 1 encapsulin nanocompartment shell protein | - |
| M3330_RS08525 | 1830523..1831551 | - | 1029 | WP_033096849.1 | Dyp-type peroxidase | - |
| M3330_RS08530 | 1831628..1833229 | - | 1602 | WP_033096850.1 | L-lactate permease | - |
| M3330_RS08535 | 1833234..1833662 | - | 429 | WP_024102975.1 | HIT family protein | - |
| M3330_RS08540 | 1833659..1834285 | - | 627 | WP_231913210.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10268.82 Da Isoelectric Point: 10.2002
>T244881 WP_024102981.1 NZ_CP097186:c1829205-1828927 [Rhodococcus sp. GA1]
MSTPDHPYRLVMARSAARAMARSLPEKVATAVYEFVTGPLLENPKRVGKPLNPPLAPAYSARRGEYRVLYLIDDANRTVE
VTAISHRADAYR
MSTPDHPYRLVMARSAARAMARSLPEKVATAVYEFVTGPLLENPKRVGKPLNPPLAPAYSARRGEYRVLYLIDDANRTVE
VTAISHRADAYR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|