Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 9030..9631 Replicon plasmid pYUSHP31-2
Accession NZ_CP097183
Organism Escherichia coli strain SH21PTE31

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag M4R35_RS23530 Protein ID WP_001216034.1
Coordinates 9251..9631 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M4R35_RS23525 Protein ID WP_001190712.1
Coordinates 9030..9251 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4R35_RS23515 6035..7294 - 1260 WP_094310829.1 restriction endonuclease subunit S -
M4R35_RS23520 7291..8847 - 1557 WP_047633096.1 type I restriction-modification system subunit M -
M4R35_RS23525 9030..9251 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4R35_RS23530 9251..9631 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4R35_RS23535 9636..9815 + 180 WP_001513661.1 hypothetical protein -
M4R35_RS23540 9843..10121 + 279 Protein_9 pdcB -
M4R35_RS23545 10126..10539 + 414 Protein_10 integrase core domain-containing protein -
M4R35_RS23550 10489..10824 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
M4R35_RS23555 11034..12014 - 981 WP_249398386.1 IS5-like element IS5 family transposase -
M4R35_RS23560 12258..13661 + 1404 WP_001373486.1 S-methylmethionine permease -
M4R35_RS23565 13648..14580 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..64527 64527
- inside IScluster/Tn - - 10165..38775 28610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T244879 WP_001216034.1 NZ_CP097183:9251-9631 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT244879 WP_001190712.1 NZ_CP097183:9030-9251 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References