Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 9030..9631 | Replicon | plasmid pYUSHP31-2 |
| Accession | NZ_CP097183 | ||
| Organism | Escherichia coli strain SH21PTE31 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | M4R35_RS23530 | Protein ID | WP_001216034.1 |
| Coordinates | 9251..9631 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | M4R35_RS23525 | Protein ID | WP_001190712.1 |
| Coordinates | 9030..9251 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4R35_RS23515 | 6035..7294 | - | 1260 | WP_094310829.1 | restriction endonuclease subunit S | - |
| M4R35_RS23520 | 7291..8847 | - | 1557 | WP_047633096.1 | type I restriction-modification system subunit M | - |
| M4R35_RS23525 | 9030..9251 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M4R35_RS23530 | 9251..9631 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M4R35_RS23535 | 9636..9815 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| M4R35_RS23540 | 9843..10121 | + | 279 | Protein_9 | pdcB | - |
| M4R35_RS23545 | 10126..10539 | + | 414 | Protein_10 | integrase core domain-containing protein | - |
| M4R35_RS23550 | 10489..10824 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| M4R35_RS23555 | 11034..12014 | - | 981 | WP_249398386.1 | IS5-like element IS5 family transposase | - |
| M4R35_RS23560 | 12258..13661 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| M4R35_RS23565 | 13648..14580 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..64527 | 64527 | |
| - | inside | IScluster/Tn | - | - | 10165..38775 | 28610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T244879 WP_001216034.1 NZ_CP097183:9251-9631 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |