Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 66966..67488 Replicon plasmid pYUSHP31-1
Accession NZ_CP097182
Organism Escherichia coli strain SH21PTE31

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M4R35_RS23320 Protein ID WP_000220560.1
Coordinates 67207..67488 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M4R35_RS23315 Protein ID WP_000121743.1
Coordinates 66966..67217 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4R35_RS23290 62637..62918 + 282 WP_001185482.1 hypothetical protein -
M4R35_RS23295 62943..63920 + 978 WP_024245156.1 hypothetical protein -
M4R35_RS23300 63917..64273 - 357 WP_000456533.1 DNA distortion polypeptide 3 -
M4R35_RS23305 64410..64856 - 447 Protein_78 hypothetical protein -
M4R35_RS23310 64896..65732 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
M4R35_RS23315 66966..67217 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M4R35_RS23320 67207..67488 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M4R35_RS23325 67563..68260 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
M4R35_RS23330 68406..68663 + 258 WP_105278499.1 hypothetical protein -
M4R35_RS23335 68700..69668 - 969 WP_077783444.1 IS5 family transposase -
M4R35_RS23340 69688..69978 + 291 WP_073503549.1 peptidoglycan DD-metalloendopeptidase family protein -
M4R35_RS23345 70012..70209 - 198 WP_000843497.1 DUF2933 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mef(B) / sul3 / dfrA5 / tet(X4) / floR / tet(A) / blaTEM-1B / tet(M) / qnrS1 - 1..104161 104161
- flank IS/Tn - - 68700..69668 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T244878 WP_000220560.1 NZ_CP097182:67207-67488 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT244878 WP_000121743.1 NZ_CP097182:66966-67217 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References