Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3434634..3435252 | Replicon | chromosome |
| Accession | NZ_CP097181 | ||
| Organism | Escherichia coli strain SH21PTE31 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M4R35_RS16690 | Protein ID | WP_001291435.1 |
| Coordinates | 3435034..3435252 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M4R35_RS16685 | Protein ID | WP_000344800.1 |
| Coordinates | 3434634..3435008 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4R35_RS16675 (3429723) | 3429723..3430916 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M4R35_RS16680 (3430939) | 3430939..3434088 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| M4R35_RS16685 (3434634) | 3434634..3435008 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M4R35_RS16690 (3435034) | 3435034..3435252 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M4R35_RS16695 (3435424) | 3435424..3435975 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| M4R35_RS16700 (3436091) | 3436091..3436561 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M4R35_RS16705 (3436725) | 3436725..3438275 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M4R35_RS16710 (3438317) | 3438317..3438624 | - | 308 | Protein_3284 | DUF1428 family protein | - |
| M4R35_RS16720 (3439003) | 3439003..3439314 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| M4R35_RS16725 (3439345) | 3439345..3439917 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244874 WP_001291435.1 NZ_CP097181:3435034-3435252 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT244874 WP_000344800.1 NZ_CP097181:3434634-3435008 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |