Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1892518..1893349 Replicon chromosome
Accession NZ_CP097181
Organism Escherichia coli strain SH21PTE31

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M4R35_RS09190 Protein ID WP_000854814.1
Coordinates 1892518..1892892 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag M4R35_RS09195 Protein ID WP_001285585.1
Coordinates 1892981..1893349 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4R35_RS09150 (1887914) 1887914..1889080 + 1167 WP_016247321.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M4R35_RS09155 (1889199) 1889199..1889672 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
M4R35_RS09160 (1889870) 1889870..1890928 + 1059 WP_064670363.1 FUSC family protein -
M4R35_RS09165 (1891100) 1891100..1891429 + 330 WP_000450409.1 DUF496 family protein -
M4R35_RS09170 (1891530) 1891530..1891664 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
M4R35_RS09175 (1891784) 1891784..1891912 + 129 Protein_1805 transposase domain-containing protein -
M4R35_RS09180 (1892201) 1892201..1892281 - 81 Protein_1806 hypothetical protein -
M4R35_RS09185 (1892327) 1892327..1892521 - 195 WP_000988600.1 DUF5983 family protein -
M4R35_RS09190 (1892518) 1892518..1892892 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M4R35_RS09195 (1892981) 1892981..1893349 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M4R35_RS09200 (1893423) 1893423..1893644 - 222 WP_000692323.1 DUF987 domain-containing protein -
M4R35_RS09205 (1893707) 1893707..1894183 - 477 WP_001186773.1 RadC family protein -
M4R35_RS09210 (1894199) 1894199..1894678 - 480 WP_000860076.1 antirestriction protein -
M4R35_RS09215 (1894760) 1894760..1895581 - 822 WP_064670364.1 DUF932 domain-containing protein -
M4R35_RS09220 (1895802) 1895802..1896212 - 411 WP_000846713.1 hypothetical protein -
M4R35_RS09225 (1896228) 1896228..1896911 - 684 WP_000775500.1 hypothetical protein -
M4R35_RS09230 (1897047) 1897047..1898117 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1846009..1901236 55227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T244867 WP_000854814.1 NZ_CP097181:c1892892-1892518 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT244867 WP_001285585.1 NZ_CP097181:c1893349-1892981 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References