Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 893293..893947 | Replicon | chromosome |
| Accession | NZ_CP097181 | ||
| Organism | Escherichia coli strain SH21PTE31 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M4R35_RS04405 | Protein ID | WP_151140359.1 |
| Coordinates | 893540..893947 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M4R35_RS04400 | Protein ID | WP_000354046.1 |
| Coordinates | 893293..893559 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4R35_RS04380 (889262) | 889262..890695 | - | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
| M4R35_RS04385 (890740) | 890740..891051 | + | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
| M4R35_RS04390 (891215) | 891215..891874 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M4R35_RS04395 (892070) | 892070..893050 | - | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
| M4R35_RS04400 (893293) | 893293..893559 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M4R35_RS04405 (893540) | 893540..893947 | + | 408 | WP_151140359.1 | protein YgfX | Toxin |
| M4R35_RS04410 (893987) | 893987..894508 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M4R35_RS04415 (894620) | 894620..895516 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M4R35_RS04420 (895541) | 895541..896251 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M4R35_RS04425 (896257) | 896257..897990 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16032.95 Da Isoelectric Point: 11.2506
>T244865 WP_151140359.1 NZ_CP097181:893540-893947 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRIDARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRIDARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |