Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 17468..18111 | Replicon | plasmid pAR13438_1 |
| Accession | NZ_CP097171 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | M3M51_RS23895 | Protein ID | WP_001044768.1 |
| Coordinates | 17695..18111 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | M3M51_RS23890 | Protein ID | WP_001261287.1 |
| Coordinates | 17468..17698 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS23870 (12628) | 12628..13716 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| M3M51_RS23875 (13718) | 13718..15943 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| M3M51_RS23880 (15993) | 15993..16892 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| M3M51_RS23885 (16882) | 16882..17172 | - | 291 | WP_000111771.1 | hypothetical protein | - |
| M3M51_RS23890 (17468) | 17468..17698 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3M51_RS23895 (17695) | 17695..18111 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3M51_RS23900 (18273) | 18273..20411 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
| M3M51_RS23905 (20765) | 20765..21022 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| M3M51_RS23910 (21022) | 21022..21612 | + | 591 | WP_000194574.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / sul1 / rmtB / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-27 / mph(A) / sitABCD | - | 1..124392 | 124392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T244853 WP_001044768.1 NZ_CP097171:17695-18111 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |