Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4740334..4740950 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A176ZIX8 |
| Locus tag | M3M51_RS22760 | Protein ID | WP_001129490.1 |
| Coordinates | 4740334..4740708 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1M0CY48 |
| Locus tag | M3M51_RS22765 | Protein ID | WP_001275523.1 |
| Coordinates | 4740708..4740950 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS22745 (4737837) | 4737837..4738739 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| M3M51_RS22750 (4738736) | 4738736..4739371 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M3M51_RS22755 (4739368) | 4739368..4740297 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| M3M51_RS22760 (4740334) | 4740334..4740708 | - | 375 | WP_001129490.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3M51_RS22765 (4740708) | 4740708..4740950 | - | 243 | WP_001275523.1 | CopG family transcriptional regulator | Antitoxin |
| M3M51_RS22770 (4741170) | 4741170..4741388 | - | 219 | WP_001251290.1 | CopG family transcriptional regulator | - |
| M3M51_RS22775 (4742062) | 4742062..4742976 | - | 915 | WP_072649161.1 | transposase | - |
| M3M51_RS22780 (4742989) | 4742989..4743876 | - | 888 | Protein_4457 | hypothetical protein | - |
| M3M51_RS22785 (4744292) | 4744292..4745233 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| M3M51_RS22790 (4745278) | 4745278..4745715 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13960.19 Da Isoelectric Point: 7.0126
>T244852 WP_001129490.1 NZ_CP097170:c4740708-4740334 [Escherichia coli]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A176ZIX8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0CY48 |