Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4322795..4323390 | Replicon | chromosome |
Accession | NZ_CP097170 | ||
Organism | Escherichia coli strain AR13438 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | M3M51_RS20815 | Protein ID | WP_000239581.1 |
Coordinates | 4322795..4323145 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | M3M51_RS20820 | Protein ID | WP_001223213.1 |
Coordinates | 4323139..4323390 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M51_RS20795 (4318249) | 4318249..4319271 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
M3M51_RS20800 (4319285) | 4319285..4320787 | - | 1503 | WP_001095661.1 | ATP-binding cassette domain-containing protein | - |
M3M51_RS20805 (4320920) | 4320920..4321876 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
M3M51_RS20810 (4322186) | 4322186..4322716 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
M3M51_RS20815 (4322795) | 4322795..4323145 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
M3M51_RS20820 (4323139) | 4323139..4323390 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
M3M51_RS20825 (4323602) | 4323602..4323943 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
M3M51_RS20830 (4323946) | 4323946..4327725 | - | 3780 | WP_000060873.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T244850 WP_000239581.1 NZ_CP097170:c4323145-4322795 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|