Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3791880..3792717 | Replicon | chromosome |
Accession | NZ_CP097170 | ||
Organism | Escherichia coli strain AR13438 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A1M0D5U3 |
Locus tag | M3M51_RS18255 | Protein ID | WP_000227782.1 |
Coordinates | 3792175..3792717 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | M3M51_RS18250 | Protein ID | WP_001353405.1 |
Coordinates | 3791880..3792191 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M51_RS18225 (3786900) | 3786900..3787847 | + | 948 | WP_001239437.1 | cytochrome o ubiquinol oxidase subunit II | - |
M3M51_RS18230 (3787869) | 3787869..3789860 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
M3M51_RS18235 (3789850) | 3789850..3790464 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M3M51_RS18240 (3790464) | 3790464..3790793 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M3M51_RS18245 (3790805) | 3790805..3791695 | + | 891 | WP_000971327.1 | heme o synthase | - |
M3M51_RS18250 (3791880) | 3791880..3792191 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
M3M51_RS18255 (3792175) | 3792175..3792717 | + | 543 | WP_000227782.1 | GNAT family N-acetyltransferase | Toxin |
M3M51_RS18260 (3792773) | 3792773..3793617 | - | 845 | Protein_3581 | tetratricopeptide repeat protein | - |
M3M51_RS18265 (3794024) | 3794024..3795388 | + | 1365 | WP_001000978.1 | MFS transporter | - |
M3M51_RS18270 (3795516) | 3795516..3796007 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
M3M51_RS18275 (3796175) | 3796175..3797086 | + | 912 | WP_000705841.1 | 2-dehydropantoate 2-reductase | - |
M3M51_RS18280 (3797049) | 3797049..3797639 | + | 591 | WP_001276320.1 | protein deglycase YajL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19957.31 Da Isoelectric Point: 9.1763
>T244847 WP_000227782.1 NZ_CP097170:3792175-3792717 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0D5U3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |