Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3757790..3758408 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M3M51_RS18085 | Protein ID | WP_001291435.1 |
| Coordinates | 3758190..3758408 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M3M51_RS18080 | Protein ID | WP_000344800.1 |
| Coordinates | 3757790..3758164 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS18070 (3752879) | 3752879..3754072 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M3M51_RS18075 (3754095) | 3754095..3757244 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| M3M51_RS18080 (3757790) | 3757790..3758164 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M3M51_RS18085 (3758190) | 3758190..3758408 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M3M51_RS18090 (3758580) | 3758580..3759131 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
| M3M51_RS18095 (3759247) | 3759247..3759717 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M3M51_RS18100 (3759881) | 3759881..3761431 | + | 1551 | WP_001361689.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M3M51_RS18105 (3761473) | 3761473..3761826 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M3M51_RS18115 (3762205) | 3762205..3762516 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| M3M51_RS18120 (3762547) | 3762547..3763119 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244846 WP_001291435.1 NZ_CP097170:3758190-3758408 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT244846 WP_000344800.1 NZ_CP097170:3757790-3758164 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |