Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3328697..3329402 | Replicon | chromosome |
Accession | NZ_CP097170 | ||
Organism | Escherichia coli strain AR13438 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1M2J6W7 |
Locus tag | M3M51_RS15915 | Protein ID | WP_000539524.1 |
Coordinates | 3328697..3329083 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M3M51_RS15920 | Protein ID | WP_001280945.1 |
Coordinates | 3329073..3329402 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M51_RS15895 (3324701) | 3324701..3325327 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M3M51_RS15900 (3325324) | 3325324..3326439 | - | 1116 | WP_000555056.1 | aldose sugar dehydrogenase YliI | - |
M3M51_RS15905 (3326550) | 3326550..3326933 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M3M51_RS15910 (3327146) | 3327146..3328471 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M3M51_RS15915 (3328697) | 3328697..3329083 | + | 387 | WP_000539524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3M51_RS15920 (3329073) | 3329073..3329402 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M3M51_RS15925 (3329472) | 3329472..3330789 | - | 1318 | Protein_3130 | diguanylate cyclase | - |
M3M51_RS15930 (3330797) | 3330797..3333145 | - | 2349 | WP_000950331.1 | EAL domain-containing protein | - |
M3M51_RS15935 (3333322) | 3333322..3334233 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14321.46 Da Isoelectric Point: 9.9521
>T244844 WP_000539524.1 NZ_CP097170:3328697-3329083 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|