Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1259529..1260112 | Replicon | chromosome |
Accession | NZ_CP097170 | ||
Organism | Escherichia coli strain AR13438 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | M3M51_RS06060 | Protein ID | WP_000254738.1 |
Coordinates | 1259777..1260112 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1M2IZI3 |
Locus tag | M3M51_RS06055 | Protein ID | WP_000581940.1 |
Coordinates | 1259529..1259777 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M51_RS06045 (1255868) | 1255868..1257169 | + | 1302 | WP_000046818.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
M3M51_RS06050 (1257217) | 1257217..1259451 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
M3M51_RS06055 (1259529) | 1259529..1259777 | + | 249 | WP_000581940.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M3M51_RS06060 (1259777) | 1259777..1260112 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
M3M51_RS06065 (1260184) | 1260184..1260975 | + | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
M3M51_RS06070 (1261203) | 1261203..1262840 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
M3M51_RS06075 (1262927) | 1262927..1264225 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T244837 WP_000254738.1 NZ_CP097170:1259777-1260112 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|