Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1136247..1136901 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M3M51_RS05545 | Protein ID | WP_000244781.1 |
| Coordinates | 1136494..1136901 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M3M51_RS05540 | Protein ID | WP_000354046.1 |
| Coordinates | 1136247..1136513 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS05520 (1132335) | 1132335..1133768 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
| M3M51_RS05525 (1133813) | 1133813..1134124 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
| M3M51_RS05530 (1134288) | 1134288..1134947 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| M3M51_RS05535 (1135024) | 1135024..1136004 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| M3M51_RS05540 (1136247) | 1136247..1136513 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M3M51_RS05545 (1136494) | 1136494..1136901 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M3M51_RS05550 (1136941) | 1136941..1137462 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
| M3M51_RS05555 (1137574) | 1137574..1138470 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M3M51_RS05560 (1138495) | 1138495..1139205 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M3M51_RS05565 (1139211) | 1139211..1140944 | + | 1734 | WP_063117505.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T244836 WP_000244781.1 NZ_CP097170:1136494-1136901 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|