Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 950940..951738 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M3M51_RS04570 | Protein ID | WP_106489677.1 |
| Coordinates | 950940..951317 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | M3M51_RS04575 | Protein ID | WP_001285415.1 |
| Coordinates | 951364..951738 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS04540 (947069) | 947069..947602 | - | 534 | WP_077250167.1 | hypothetical protein | - |
| M3M51_RS04545 (948637) | 948637..948963 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M3M51_RS04550 (948960) | 948960..949223 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| M3M51_RS04555 (949295) | 949295..950161 | - | 867 | WP_001280433.1 | DUF4942 domain-containing protein | - |
| M3M51_RS04560 (950246) | 950246..950443 | - | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| M3M51_RS04565 (950455) | 950455..950943 | - | 489 | WP_000761676.1 | DUF5983 family protein | - |
| M3M51_RS04570 (950940) | 950940..951317 | - | 378 | WP_106489677.1 | TA system toxin CbtA family protein | Toxin |
| M3M51_RS04575 (951364) | 951364..951738 | - | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M3M51_RS04580 (951818) | 951818..952039 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| M3M51_RS04585 (952102) | 952102..952578 | - | 477 | WP_001366855.1 | RadC family protein | - |
| M3M51_RS04590 (952594) | 952594..953073 | - | 480 | WP_000844100.1 | antirestriction protein | - |
| M3M51_RS04595 (953155) | 953155..953973 | - | 819 | WP_001175148.1 | DUF932 domain-containing protein | - |
| M3M51_RS04600 (954063) | 954063..954296 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| M3M51_RS04605 (954302) | 954302..954979 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| M3M51_RS04610 (955127) | 955127..955807 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sfaX | 902197..962995 | 60798 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14007.04 Da Isoelectric Point: 8.1476
>T244835 WP_106489677.1 NZ_CP097170:c951317-950940 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT244835 WP_001285415.1 NZ_CP097170:c951738-951364 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|