Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 894498..895296 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0HL60 |
| Locus tag | M3M51_RS04270 | Protein ID | WP_000854692.1 |
| Coordinates | 894498..894875 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
| Locus tag | M3M51_RS04275 | Protein ID | WP_001605875.1 |
| Coordinates | 894922..895296 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS04240 (889637) | 889637..890785 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| M3M51_RS04245 (890857) | 890857..891840 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| M3M51_RS04250 (892639) | 892639..892809 | - | 171 | Protein_836 | IS110 family transposase | - |
| M3M51_RS04255 (893152) | 893152..893994 | - | 843 | WP_001280485.1 | DUF4942 domain-containing protein | - |
| M3M51_RS04260 (894079) | 894079..894276 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| M3M51_RS04265 (894352) | 894352..894501 | - | 150 | Protein_839 | DUF5983 family protein | - |
| M3M51_RS04270 (894498) | 894498..894875 | - | 378 | WP_000854692.1 | TA system toxin CbtA family protein | Toxin |
| M3M51_RS04275 (894922) | 894922..895296 | - | 375 | WP_001605875.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M3M51_RS04280 (895372) | 895372..895593 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| M3M51_RS04285 (895662) | 895662..896138 | - | 477 | WP_001186181.1 | RadC family protein | - |
| M3M51_RS04290 (896154) | 896154..896639 | - | 486 | WP_000213727.1 | antirestriction protein | - |
| M3M51_RS04295 (896731) | 896731..897549 | - | 819 | WP_106489678.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 892639..892743 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14119.12 Da Isoelectric Point: 7.3249
>T244834 WP_000854692.1 NZ_CP097170:c894875-894498 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT244834 WP_001605875.1 NZ_CP097170:c895296-894922 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0HL60 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L4NTN5 |