Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 70672..71470 | Replicon | chromosome |
| Accession | NZ_CP097170 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M3M51_RS00305 | Protein ID | WP_106489677.1 |
| Coordinates | 70672..71049 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | M3M51_RS00310 | Protein ID | WP_001285415.1 |
| Coordinates | 71096..71470 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS00275 (66017) | 66017..66940 | - | 924 | WP_000535959.1 | carboxylate/amino acid/amine transporter | - |
| M3M51_RS00280 (67051) | 67051..68235 | - | 1185 | WP_001172864.1 | sugar efflux transporter | - |
| M3M51_RS00285 (68634) | 68634..68795 | - | 162 | Protein_56 | RhuM family protein | - |
| M3M51_RS00290 (69033) | 69033..69875 | - | 843 | WP_000036706.1 | DUF4942 domain-containing protein | - |
| M3M51_RS00295 (69972) | 69972..70169 | - | 198 | WP_000839266.1 | DUF957 domain-containing protein | - |
| M3M51_RS00300 (70187) | 70187..70675 | - | 489 | WP_000761680.1 | DUF5983 family protein | - |
| M3M51_RS00305 (70672) | 70672..71049 | - | 378 | WP_106489677.1 | TA system toxin CbtA family protein | Toxin |
| M3M51_RS00310 (71096) | 71096..71470 | - | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M3M51_RS00315 (71550) | 71550..71771 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| M3M51_RS00320 (71834) | 71834..72310 | - | 477 | WP_001366855.1 | RadC family protein | - |
| M3M51_RS00325 (72326) | 72326..72805 | - | 480 | WP_063624909.1 | antirestriction protein | - |
| M3M51_RS00330 (72887) | 72887..73705 | - | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| M3M51_RS00335 (73804) | 73804..74037 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| M3M51_RS00340 (74043) | 74043..74720 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| M3M51_RS00345 (74868) | 74868..75548 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 59308..131854 | 72546 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14007.04 Da Isoelectric Point: 8.1476
>T244829 WP_106489677.1 NZ_CP097170:c71049-70672 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCNAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT244829 WP_001285415.1 NZ_CP097170:c71470-71096 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|