Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 8170..8810 | Replicon | plasmid unnamed9 |
Accession | NZ_CP097155 | ||
Organism | Deinococcus sp. QL22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M1R55_RS27830 | Protein ID | WP_249396460.1 |
Coordinates | 8403..8810 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M1R55_RS27825 | Protein ID | WP_249396459.1 |
Coordinates | 8170..8406 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1R55_RS27815 (M1R55_27810) | 4930..6045 | - | 1116 | WP_249396457.1 | diguanylate cyclase | - |
M1R55_RS27820 (M1R55_27815) | 6730..8088 | + | 1359 | WP_249396458.1 | hypothetical protein | - |
M1R55_RS27825 (M1R55_27820) | 8170..8406 | + | 237 | WP_249396459.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M1R55_RS27830 (M1R55_27825) | 8403..8810 | + | 408 | WP_249396460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M1R55_RS27835 (M1R55_27830) | 8921..9202 | + | 282 | WP_249396461.1 | HNH endonuclease | - |
M1R55_RS27840 (M1R55_27835) | 9223..9933 | - | 711 | WP_249396462.1 | IS6 family transposase | - |
M1R55_RS31920 | 9920..10054 | + | 135 | WP_256566078.1 | hypothetical protein | - |
M1R55_RS27845 (M1R55_27840) | 10095..10415 | - | 321 | WP_249396463.1 | hypothetical protein | - |
M1R55_RS27850 (M1R55_27845) | 10526..11548 | - | 1023 | WP_249396464.1 | site-specific integrase | - |
M1R55_RS27855 (M1R55_27850) | 11670..13055 | - | 1386 | WP_249396465.1 | toll/interleukin-1 receptor domain-containing protein | - |
M1R55_RS27860 (M1R55_27855) | 13182..13525 | + | 344 | Protein_16 | IS982 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..201406 | 201406 | |
- | flank | IS/Tn | - | - | 9223..9897 | 674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14860.14 Da Isoelectric Point: 6.7195
>T244827 WP_249396460.1 NZ_CP097155:8403-8810 [Deinococcus sp. QL22]
MTLRYLLDTNICIFIIKNKPAAVRERFTGLRPGEVGLSAVTEAELLHGVYKSIRVEHNLAAVLDFASQLVIVPFDSQVAD
TYGRIRAELEKAGQPIGPLDFQIAATAVAHGLTLVTNNTREFARAPGLRMEDWTP
MTLRYLLDTNICIFIIKNKPAAVRERFTGLRPGEVGLSAVTEAELLHGVYKSIRVEHNLAAVLDFASQLVIVPFDSQVAD
TYGRIRAELEKAGQPIGPLDFQIAATAVAHGLTLVTNNTREFARAPGLRMEDWTP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|