Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1319164..1320080 | Replicon | chromosome |
| Accession | NZ_CP097130 | ||
| Organism | Bacillus subtilis strain S16 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | M2M89_RS06875 | Protein ID | WP_003244695.1 |
| Coordinates | 1319334..1320080 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | M2M89_RS06870 | Protein ID | WP_003232646.1 |
| Coordinates | 1319164..1319334 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2M89_RS06835 (1316027) | 1316027..1316356 | + | 330 | WP_041850928.1 | XkdW family protein | - |
| M2M89_RS06840 (1316353) | 1316353..1316517 | + | 165 | WP_041850927.1 | XkdX family protein | - |
| M2M89_RS06845 (1316561) | 1316561..1317400 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
| M2M89_RS06850 (1317453) | 1317453..1317722 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| M2M89_RS06855 (1317735) | 1317735..1317998 | + | 264 | WP_003232653.1 | phage holin | - |
| M2M89_RS06860 (1318011) | 1318011..1318904 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
| M2M89_RS06865 (1318941) | 1318941..1319078 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| M2M89_RS06870 (1319164) | 1319164..1319334 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| M2M89_RS06875 (1319334) | 1319334..1320080 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| M2M89_RS06880 (1320190) | 1320190..1321191 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| M2M89_RS06885 (1321204) | 1321204..1321821 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| M2M89_RS06890 (1322097) | 1322097..1323413 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
| M2M89_RS06895 (1323801) | 1323801..1324751 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
| M2M89_RS06900 (1324852) | 1324852..1324998 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T244822 WP_003244695.1 NZ_CP097130:c1320080-1319334 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|