Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 520987..521623 | Replicon | chromosome |
| Accession | NZ_CP097130 | ||
| Organism | Bacillus subtilis strain S16 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | M2M89_RS02625 | Protein ID | WP_003156187.1 |
| Coordinates | 521273..521623 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | M2M89_RS02620 | Protein ID | WP_003225183.1 |
| Coordinates | 520987..521268 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2M89_RS02600 (517347) | 517347..517946 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
| M2M89_RS02605 (518041) | 518041..518406 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
| M2M89_RS02610 (518572) | 518572..519588 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
| M2M89_RS02615 (519702) | 519702..520871 | + | 1170 | WP_015252766.1 | alanine racemase | - |
| M2M89_RS02620 (520987) | 520987..521268 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| M2M89_RS02625 (521273) | 521273..521623 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M2M89_RS02630 (521738) | 521738..522562 | + | 825 | WP_128441371.1 | RsbT co-antagonist protein RsbRA | - |
| M2M89_RS02635 (522567) | 522567..522932 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| M2M89_RS02640 (522936) | 522936..523337 | + | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
| M2M89_RS02645 (523349) | 523349..524356 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
| M2M89_RS02650 (524425) | 524425..524754 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
| M2M89_RS02655 (524751) | 524751..525233 | + | 483 | WP_021481702.1 | anti-sigma B factor RsbW | - |
| M2M89_RS02660 (525199) | 525199..525987 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| M2M89_RS02665 (525987) | 525987..526586 | + | 600 | WP_021481701.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T244821 WP_003156187.1 NZ_CP097130:521273-521623 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|