Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3007906..3008537 | Replicon | chromosome |
| Accession | NZ_CP097128 | ||
| Organism | Conexibacter sp. DBS9H8 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M3M55_RS14350 | Protein ID | WP_249010185.1 |
| Coordinates | 3007906..3008292 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M3M55_RS14355 | Protein ID | WP_249010186.1 |
| Coordinates | 3008289..3008537 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M55_RS14325 | 3003090..3004502 | + | 1413 | WP_249010180.1 | MBL fold metallo-hydrolase | - |
| M3M55_RS14330 | 3004590..3005045 | - | 456 | WP_249010181.1 | ester cyclase | - |
| M3M55_RS14335 | 3005103..3005789 | - | 687 | WP_249010182.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| M3M55_RS14340 | 3005820..3007106 | + | 1287 | WP_249010183.1 | MFS transporter | - |
| M3M55_RS14345 | 3007432..3007665 | + | 234 | WP_249010184.1 | hypothetical protein | - |
| M3M55_RS14350 | 3007906..3008292 | - | 387 | WP_249010185.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3M55_RS14355 | 3008289..3008537 | - | 249 | WP_249010186.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3M55_RS14365 | 3008831..3009907 | - | 1077 | WP_249010187.1 | FTR1 family protein | - |
| M3M55_RS14370 | 3010041..3010940 | + | 900 | WP_249010188.1 | PHP domain-containing protein | - |
| M3M55_RS14375 | 3010969..3011619 | - | 651 | WP_249010189.1 | RNA polymerase sporulation sigma factor SigH | - |
| M3M55_RS14380 | 3011945..3012631 | - | 687 | WP_249010190.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 12963.75 Da Isoelectric Point: 4.5873
>T244820 WP_249010185.1 NZ_CP097128:c3008292-3007906 [Conexibacter sp. DBS9H8]
MIAVDSSALIAVVLGEADAERFLAAMGADAASLSAVSLTEATIVAEARQGADAVRDLELLVAGVIDRVVAVDATHARAAA
AAWRRFGKGRHPAGLNLGDCFAYATASLAGAPLLFKGNDFAQTDLPAA
MIAVDSSALIAVVLGEADAERFLAAMGADAASLSAVSLTEATIVAEARQGADAVRDLELLVAGVIDRVVAVDATHARAAA
AAWRRFGKGRHPAGLNLGDCFAYATASLAGAPLLFKGNDFAQTDLPAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|