Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 890446..891103 | Replicon | chromosome |
Accession | NZ_CP097128 | ||
Organism | Conexibacter sp. DBS9H8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3M55_RS04240 | Protein ID | WP_249011579.1 |
Coordinates | 890446..890850 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M3M55_RS04245 | Protein ID | WP_249011580.1 |
Coordinates | 890840..891103 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M55_RS04220 | 886561..887868 | + | 1308 | WP_249011576.1 | biotin/lipoyl-binding protein | - |
M3M55_RS04225 | 887960..888643 | + | 684 | WP_249012444.1 | ABC transporter ATP-binding protein | - |
M3M55_RS04230 | 888640..889872 | + | 1233 | WP_249011577.1 | ABC transporter permease | - |
M3M55_RS04235 | 890064..890351 | + | 288 | WP_249011578.1 | DUF2283 domain-containing protein | - |
M3M55_RS04240 | 890446..890850 | - | 405 | WP_249011579.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3M55_RS04245 | 890840..891103 | - | 264 | WP_249011580.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M3M55_RS04250 | 891257..891667 | - | 411 | WP_249011581.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
M3M55_RS04255 | 891664..891915 | - | 252 | WP_249011582.1 | hypothetical protein | - |
M3M55_RS04260 | 892047..892415 | + | 369 | WP_249011583.1 | metalloregulator ArsR/SmtB family transcription factor | - |
M3M55_RS04265 | 893031..893654 | + | 624 | WP_249011584.1 | DUF1778 domain-containing protein | - |
M3M55_RS04270 | 893647..894165 | + | 519 | WP_249011585.1 | GNAT family N-acetyltransferase | - |
M3M55_RS04275 | 894263..894655 | - | 393 | WP_256469069.1 | PIN domain-containing protein | - |
M3M55_RS04280 | 894652..894900 | - | 249 | WP_249011587.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14727.94 Da Isoelectric Point: 11.0408
>T244818 WP_249011579.1 NZ_CP097128:c890850-890446 [Conexibacter sp. DBS9H8]
MSADRRLSYLDSSAIVKLVIQEPESSALRRHLSRRQPVVSSALARTEVARALLPSGPEALARGEQVLRRIQLLRVNDRVL
DQAGPLEPPELRALDAIHLASAHQLGVSVRQIVTYDHRMADAARSLGWTVIAPS
MSADRRLSYLDSSAIVKLVIQEPESSALRRHLSRRQPVVSSALARTEVARALLPSGPEALARGEQVLRRIQLLRVNDRVL
DQAGPLEPPELRALDAIHLASAHQLGVSVRQIVTYDHRMADAARSLGWTVIAPS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|