Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 440140..440753 Replicon chromosome
Accession NZ_CP097128
Organism Conexibacter sp. DBS9H8

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M3M55_RS02145 Protein ID WP_256469032.1
Coordinates 440373..440753 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag M3M55_RS02140 Protein ID WP_249011177.1
Coordinates 440140..440385 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3M55_RS02100 435926..436141 + 216 WP_249011171.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M3M55_RS02105 436138..436548 + 411 WP_249011172.1 type II toxin-antitoxin system VapC family toxin -
M3M55_RS02110 436656..436916 + 261 WP_249011173.1 ribbon-helix-helix domain-containing protein -
M3M55_RS17395 437022..437156 + 135 WP_256469031.1 hypothetical protein -
M3M55_RS02115 437268..437543 - 276 WP_249011174.1 hypothetical protein -
M3M55_RS02120 437676..438245 + 570 WP_249011119.1 DUF6431 domain-containing protein -
M3M55_RS02125 438570..439277 + 708 Protein_423 site-specific integrase -
M3M55_RS02130 439379..439687 + 309 WP_249011175.1 nucleotidyltransferase family protein -
M3M55_RS02135 439684..440022 + 339 WP_249011176.1 DUF86 domain-containing protein -
M3M55_RS02140 440140..440385 + 246 WP_249011177.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
M3M55_RS02145 440373..440753 + 381 WP_256469032.1 PIN domain-containing protein Toxin
M3M55_RS02150 441095..441796 + 702 WP_249011179.1 class I SAM-dependent methyltransferase -
M3M55_RS02155 442639..443769 - 1131 WP_249011180.1 site-specific integrase -
M3M55_RS02160 443784..444179 - 396 WP_249011181.1 excisionase family DNA-binding protein -
M3M55_RS02165 444287..444847 + 561 WP_249011182.1 hypothetical protein -
M3M55_RS02170 444837..445271 + 435 WP_249011183.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 436656..447507 10851


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13702.71 Da        Isoelectric Point: 4.9205

>T244817 WP_256469032.1 NZ_CP097128:440373-440753 [Conexibacter sp. DBS9H8]
VERLILDTSVLIDPVDLPEDAQAAISAVSIAELHFGLLVADETTRPLRAARLGLIESRFTPLPLDDKVAREWGRLQAAVA
SRDANPRKRSADLAIAATANVHEATLLTRNLKDFTIIEDLLRVSGV

Download         Length: 381 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8890.16 Da        Isoelectric Point: 4.9987

>AT244817 WP_249011177.1 NZ_CP097128:440140-440385 [Conexibacter sp. DBS9H8]
VTTIQQKQLRNEVGDVLRRAEAGEEFIVTVAGRPVAQIGPLQRDTWVPTRRLQDLLKLPADPALAADLDIFKAGLSDPWS
G

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References