Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3341425..3342170 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M3M54_RS16005 | Protein ID | WP_249020021.1 |
Coordinates | 3341673..3342170 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | M3M54_RS16000 | Protein ID | WP_249020020.1 |
Coordinates | 3341425..3341676 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS15965 | 3336774..3337565 | - | 792 | WP_249020014.1 | sigma-70 family RNA polymerase sigma factor | - |
M3M54_RS15970 | 3337611..3337832 | + | 222 | WP_249020015.1 | DUF2892 domain-containing protein | - |
M3M54_RS15975 | 3337937..3338875 | + | 939 | WP_249021793.1 | ATP-binding cassette domain-containing protein | - |
M3M54_RS15980 | 3338872..3339636 | + | 765 | WP_249020016.1 | ABC transporter permease | - |
M3M54_RS15985 | 3339740..3340165 | + | 426 | WP_249020017.1 | hypothetical protein | - |
M3M54_RS15990 | 3340162..3340635 | + | 474 | WP_249020018.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
M3M54_RS15995 | 3340911..3341255 | + | 345 | WP_249020019.1 | hypothetical protein | - |
M3M54_RS16000 | 3341425..3341676 | + | 252 | WP_249020020.1 | DUF1778 domain-containing protein | Antitoxin |
M3M54_RS16005 | 3341673..3342170 | + | 498 | WP_249020021.1 | GNAT family N-acetyltransferase | Toxin |
M3M54_RS16010 | 3342426..3342596 | - | 171 | WP_249020022.1 | hypothetical protein | - |
M3M54_RS16015 | 3343006..3343302 | - | 297 | WP_249020023.1 | hypothetical protein | - |
M3M54_RS16020 | 3343289..3343546 | - | 258 | WP_249020024.1 | hypothetical protein | - |
M3M54_RS16030 | 3343888..3344352 | - | 465 | WP_249020025.1 | tRNA adenosine(34) deaminase TadA | - |
M3M54_RS16035 | 3344506..3346137 | + | 1632 | WP_249020026.1 | S8 family serine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18065.74 Da Isoelectric Point: 10.3226
>T244814 WP_249020021.1 NZ_CP097127:3341673-3342170 [Conexibacter sp. S30A1]
MSDLRIGPLERGHQLEAFASGADELDRWLHRFARVADASGTAKTYVLANGNRVLGYYALTPAAVNRHELPERHAKGMPAR
PIGVILLARLAVDGSFQGQGYGRALMADAAIRTLQAADLVGARAMLVHARDERAASFYERLGFTRSPTDALHLMVLIKDL
RRTFG
MSDLRIGPLERGHQLEAFASGADELDRWLHRFARVADASGTAKTYVLANGNRVLGYYALTPAAVNRHELPERHAKGMPAR
PIGVILLARLAVDGSFQGQGYGRALMADAAIRTLQAADLVGARAMLVHARDERAASFYERLGFTRSPTDALHLMVLIKDL
RRTFG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|