Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1397521..1398305 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | M3M54_RS06985 | Protein ID | WP_249021459.1 |
Coordinates | 1397521..1397952 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | M3M54_RS06990 | Protein ID | WP_249021460.1 |
Coordinates | 1398039..1398305 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS06965 | 1393544..1394512 | + | 969 | WP_249021455.1 | crosslink repair DNA glycosylase YcaQ family protein | - |
M3M54_RS06970 | 1395029..1395199 | + | 171 | WP_249021456.1 | hypothetical protein | - |
M3M54_RS06975 | 1395562..1396791 | - | 1230 | WP_249021457.1 | MFS transporter | - |
M3M54_RS06980 | 1396810..1397349 | - | 540 | WP_249021458.1 | winged helix-turn-helix domain-containing protein | - |
M3M54_RS06985 | 1397521..1397952 | - | 432 | WP_249021459.1 | GNAT family N-acetyltransferase | Toxin |
M3M54_RS06990 | 1398039..1398305 | - | 267 | WP_249021460.1 | DUF1778 domain-containing protein | Antitoxin |
M3M54_RS07000 | 1398695..1399087 | - | 393 | WP_249021461.1 | cupin domain-containing protein | - |
M3M54_RS07005 | 1399285..1400193 | + | 909 | WP_249021462.1 | LysR family transcriptional regulator | - |
M3M54_RS07010 | 1400201..1400740 | + | 540 | WP_249021463.1 | gluconokinase | - |
M3M54_RS07015 | 1400727..1402025 | - | 1299 | WP_249021464.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15420.99 Da Isoelectric Point: 9.9418
>T244807 WP_249021459.1 NZ_CP097127:c1397952-1397521 [Conexibacter sp. S30A1]
MTRHALQAGAAGSARTYVVLDSEQHRVVGYHALTAAGIEREAAITRVIKGMPRYPIAVVLLARLAVDLAVTGRGIGAWLL
RDAMLRTLTAAETIGVCAMLVHAQDENARRFYLKHGLEPSPTDPLHLMVLLKDLAASISSNSR
MTRHALQAGAAGSARTYVVLDSEQHRVVGYHALTAAGIEREAAITRVIKGMPRYPIAVVLLARLAVDLAVTGRGIGAWLL
RDAMLRTLTAAETIGVCAMLVHAQDENARRFYLKHGLEPSPTDPLHLMVLLKDLAASISSNSR
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|