Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 1066098..1066764 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3M54_RS05325 | Protein ID | WP_249021151.1 |
Coordinates | 1066098..1066502 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M3M54_RS05330 | Protein ID | WP_249021152.1 |
Coordinates | 1066492..1066764 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS05295 | 1062545..1063147 | - | 603 | WP_249021145.1 | biotin transporter BioY | - |
M3M54_RS05300 | 1063218..1063709 | - | 492 | WP_249021146.1 | GNAT family N-acetyltransferase | - |
M3M54_RS05305 | 1064192..1064467 | + | 276 | WP_249021147.1 | hypothetical protein | - |
M3M54_RS05310 | 1064478..1064642 | + | 165 | WP_249021148.1 | hypothetical protein | - |
M3M54_RS05315 | 1064736..1064975 | - | 240 | WP_249021149.1 | hypothetical protein | - |
M3M54_RS05320 | 1065270..1065794 | + | 525 | WP_249021150.1 | 2'-5' RNA ligase family protein | - |
M3M54_RS05325 | 1066098..1066502 | - | 405 | WP_249021151.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3M54_RS05330 | 1066492..1066764 | - | 273 | WP_249021152.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M3M54_RS05335 | 1066838..1066993 | + | 156 | WP_249021153.1 | hypothetical protein | - |
M3M54_RS05340 | 1067247..1067825 | + | 579 | WP_249021154.1 | GNAT family protein | - |
M3M54_RS05345 | 1067971..1068171 | + | 201 | WP_249021155.1 | hypothetical protein | - |
M3M54_RS05350 | 1068177..1068605 | - | 429 | WP_249021156.1 | PIN domain-containing protein | - |
M3M54_RS05355 | 1068602..1068874 | - | 273 | WP_249021157.1 | hypothetical protein | - |
M3M54_RS05360 | 1069088..1069468 | - | 381 | WP_249021158.1 | Fic family protein | - |
M3M54_RS05365 | 1069465..1069656 | - | 192 | WP_249021159.1 | hypothetical protein | - |
M3M54_RS05370 | 1070146..1070730 | + | 585 | WP_249019413.1 | DUF6431 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14632.79 Da Isoelectric Point: 11.1839
>T244805 WP_249021151.1 NZ_CP097127:c1066502-1066098 [Conexibacter sp. S30A1]
MSADQRLTYVDSSAIVKLAIQEPESSALRRHLSRHQPLVSSALARTEVARALLPSGPAALARGEQVLRRIQLLRVNDRVL
NEAGRLKPPELRSLDAIHLASAHQLGASVRQIVTYDDRMADAARTLGWTVVAPS
MSADQRLTYVDSSAIVKLAIQEPESSALRRHLSRHQPLVSSALARTEVARALLPSGPAALARGEQVLRRIQLLRVNDRVL
NEAGRLKPPELRSLDAIHLASAHQLGASVRQIVTYDDRMADAARTLGWTVVAPS
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|