Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 790600..791243 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3M54_RS03915 | Protein ID | WP_249020878.1 |
Coordinates | 790821..791243 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M3M54_RS03910 | Protein ID | WP_249020877.1 |
Coordinates | 790600..790815 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS03895 | 786272..787042 | + | 771 | WP_249020874.1 | ABC transporter ATP-binding protein | - |
M3M54_RS03900 | 787039..787836 | + | 798 | WP_249020875.1 | ABC transporter permease | - |
M3M54_RS03905 | 788132..790501 | + | 2370 | WP_249020876.1 | MMPL family transporter | - |
M3M54_RS03910 | 790600..790815 | + | 216 | WP_249020877.1 | CopG family transcriptional regulator | Antitoxin |
M3M54_RS03915 | 790821..791243 | + | 423 | WP_249020878.1 | PIN domain-containing protein | Toxin |
M3M54_RS03920 | 791366..792397 | + | 1032 | WP_249020879.1 | 3-isopropylmalate dehydrogenase | - |
M3M54_RS03925 | 792408..793343 | + | 936 | WP_249020880.1 | branched-chain amino acid transaminase | - |
M3M54_RS03930 | 793345..794946 | + | 1602 | WP_249020881.1 | citramalate synthase | - |
M3M54_RS03935 | 794943..796127 | + | 1185 | WP_249020882.1 | DegT/DnrJ/EryC1/StrS aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15178.11 Da Isoelectric Point: 4.3155
>T244804 WP_249020878.1 NZ_CP097127:790821-791243 [Conexibacter sp. S30A1]
VPTVIADTSALLAFFDASEPDHEAVSEVLAAADALIVSPYVVAELDYLVATRHGVDNELAVLDELAGGAWHLAAFDEQEL
ERARGVIASYKDLEIGVADASIVVLAERHRTRTIVSLDRRHFDVLRPIGGGYFEVLPQAR
VPTVIADTSALLAFFDASEPDHEAVSEVLAAADALIVSPYVVAELDYLVATRHGVDNELAVLDELAGGAWHLAAFDEQEL
ERARGVIASYKDLEIGVADASIVVLAERHRTRTIVSLDRRHFDVLRPIGGGYFEVLPQAR
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|