Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4565329..4565945 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | M3L74_RS22705 | Protein ID | WP_003028682.1 |
Coordinates | 4565329..4565703 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M3L74_RS22710 | Protein ID | WP_161800368.1 |
Coordinates | 4565703..4565945 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS22690 (4562832) | 4562832..4563734 | + | 903 | WP_016155183.1 | formate dehydrogenase O subunit beta | - |
M3L74_RS22695 (4563731) | 4563731..4564366 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
M3L74_RS22700 (4564363) | 4564363..4565292 | + | 930 | WP_003840450.1 | formate dehydrogenase accessory protein FdhE | - |
M3L74_RS22705 (4565329) | 4565329..4565703 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3L74_RS22710 (4565703) | 4565703..4565945 | - | 243 | WP_161800368.1 | CopG family transcriptional regulator | Antitoxin |
M3L74_RS22715 (4566151) | 4566151..4567059 | + | 909 | WP_088902891.1 | alpha/beta hydrolase | - |
M3L74_RS22720 (4567210) | 4567210..4568151 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
M3L74_RS22725 (4568196) | 4568196..4568633 | - | 438 | WP_044714708.1 | D-aminoacyl-tRNA deacylase | - |
M3L74_RS22730 (4568630) | 4568630..4569502 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
M3L74_RS22735 (4569496) | 4569496..4570095 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T244796 WP_003028682.1 NZ_CP097107:c4565703-4565329 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|