Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4264827..4265630 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M3L74_RS21350 | Protein ID | WP_088902821.1 |
Coordinates | 4265250..4265630 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A7L6TXP6 |
Locus tag | M3L74_RS21345 | Protein ID | WP_047358708.1 |
Coordinates | 4264827..4265192 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS21305 (4259900) | 4259900..4260787 | + | 888 | WP_047358715.1 | 50S ribosome-binding GTPase | - |
M3L74_RS21310 (4260993) | 4260993..4261394 | + | 402 | WP_088902817.1 | hypothetical protein | - |
M3L74_RS21315 (4261491) | 4261491..4261958 | + | 468 | WP_047358713.1 | hypothetical protein | - |
M3L74_RS21320 (4262149) | 4262149..4262400 | + | 252 | WP_047358712.1 | DUF905 family protein | - |
M3L74_RS21325 (4262518) | 4262518..4263336 | + | 819 | WP_088902818.1 | DUF932 domain-containing protein | - |
M3L74_RS21330 (4263605) | 4263605..4264078 | + | 474 | WP_047358733.1 | antirestriction protein | - |
M3L74_RS21335 (4264091) | 4264091..4264570 | + | 480 | WP_047358710.1 | DNA repair protein RadC | - |
M3L74_RS21340 (4264584) | 4264584..4264805 | + | 222 | WP_047358709.1 | DUF987 domain-containing protein | - |
M3L74_RS21345 (4264827) | 4264827..4265192 | + | 366 | WP_047358708.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M3L74_RS21350 (4265250) | 4265250..4265630 | + | 381 | WP_088902821.1 | TA system toxin CbtA family protein | Toxin |
M3L74_RS21355 (4265627) | 4265627..4266118 | + | 492 | WP_047358706.1 | DUF5983 family protein | - |
M3L74_RS21360 (4266192) | 4266192..4266359 | + | 168 | WP_072058785.1 | DUF957 domain-containing protein | - |
M3L74_RS21365 (4266440) | 4266440..4267288 | + | 849 | WP_047358705.1 | DUF4942 domain-containing protein | - |
M3L74_RS21370 (4268083) | 4268083..4269744 | + | 1662 | WP_088902822.1 | fatty acid--CoA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14182.37 Da Isoelectric Point: 10.0929
>T244795 WP_088902821.1 NZ_CP097107:4265250-4265630 [Citrobacter freundii]
MQTLSAIPTRKAPSHPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEKIITQYIDAGISLSDALNFLVEKSELVRIDRPGL
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPTRKAPSHPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEKIITQYIDAGISLSDALNFLVEKSELVRIDRPGL
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13417.25 Da Isoelectric Point: 6.4780
>AT244795 WP_047358708.1 NZ_CP097107:4264827-4265192 [Citrobacter freundii]
MSNQLPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPALLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAMYPTPDNSITR
MSNQLPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPALLKQLELMLVSGELN
PRHQHCVTLYAKGLTCEADSLGSHGYIYTAMYPTPDNSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|