Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4126290..4126806 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | M3L74_RS20605 | Protein ID | WP_003839578.1 |
Coordinates | 4126290..4126574 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | M3L74_RS20610 | Protein ID | WP_003839576.1 |
Coordinates | 4126564..4126806 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS20590 (4121516) | 4121516..4123168 | + | 1653 | WP_088902791.1 | alpha,alpha-phosphotrehalase | - |
M3L74_RS20595 (4123577) | 4123577..4125715 | + | 2139 | WP_003844922.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M3L74_RS20600 (4125822) | 4125822..4126286 | + | 465 | WP_088902792.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M3L74_RS20605 (4126290) | 4126290..4126574 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3L74_RS20610 (4126564) | 4126564..4126806 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3L74_RS20615 (4126884) | 4126884..4128797 | - | 1914 | WP_061548941.1 | BglG family transcription antiterminator | - |
M3L74_RS20620 (4128819) | 4128819..4129559 | - | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
M3L74_RS20625 (4129556) | 4129556..4130674 | - | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
M3L74_RS20630 (4130658) | 4130658..4131791 | - | 1134 | WP_049002371.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T244794 WP_003839578.1 NZ_CP097107:c4126574-4126290 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |