Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4045744..4046320 | Replicon | chromosome |
| Accession | NZ_CP097107 | ||
| Organism | Citrobacter freundii strain GMU8049 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | M3L74_RS20240 | Protein ID | WP_003837215.1 |
| Coordinates | 4046033..4046320 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | M3L74_RS20235 | Protein ID | WP_003837217.1 |
| Coordinates | 4045744..4046046 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3L74_RS20220 (4042256) | 4042256..4044406 | + | 2151 | WP_088902764.1 | pyruvate/proton symporter BtsT | - |
| M3L74_RS20225 (4044517) | 4044517..4044711 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
| M3L74_RS20230 (4044724) | 4044724..4045680 | + | 957 | WP_088902765.1 | GTPase | - |
| M3L74_RS20235 (4045744) | 4045744..4046046 | - | 303 | WP_003837217.1 | BrnA antitoxin family protein | Antitoxin |
| M3L74_RS20240 (4046033) | 4046033..4046320 | - | 288 | WP_003837215.1 | BrnT family toxin | Toxin |
| M3L74_RS20245 (4046555) | 4046555..4047721 | + | 1167 | WP_088902766.1 | restriction endonuclease | - |
| M3L74_RS20250 (4047817) | 4047817..4050246 | + | 2430 | WP_088902767.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11130.50 Da Isoelectric Point: 7.0746
>T244793 WP_003837215.1 NZ_CP097107:c4046320-4046033 [Citrobacter freundii]
MPMEFEWDANKAQSNLRKHGVRFEDAVLVFDDPQHLSRQDRHENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADSKERSRYEHG
MPMEFEWDANKAQSNLRKHGVRFEDAVLVFDDPQHLSRQDRHENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADSKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|