Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3670607..3671286 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | M3L74_RS18505 | Protein ID | WP_003031349.1 |
Coordinates | 3670945..3671286 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | M3L74_RS18500 | Protein ID | WP_003031347.1 |
Coordinates | 3670607..3670924 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS18475 (3666700) | 3666700..3668697 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
M3L74_RS18480 (3669245) | 3669245..3669392 | + | 148 | Protein_3557 | hypothetical protein | - |
M3L74_RS18485 (3669406) | 3669406..3669867 | + | 462 | WP_003031344.1 | antirestriction protein | - |
M3L74_RS18490 (3669883) | 3669883..3670359 | + | 477 | WP_003031345.1 | RadC family protein | - |
M3L74_RS18495 (3670368) | 3670368..3670589 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
M3L74_RS18500 (3670607) | 3670607..3670924 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M3L74_RS18505 (3670945) | 3670945..3671286 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
M3L74_RS18515 (3671916) | 3671916..3672224 | - | 309 | WP_003838771.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
M3L74_RS18520 (3672573) | 3672573..3673112 | - | 540 | Protein_3564 | EAL domain-containing protein | - |
M3L74_RS18525 (3673086) | 3673086..3673783 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
M3L74_RS18530 (3673777) | 3673777..3674499 | - | 723 | WP_249018276.1 | winged helix-turn-helix domain-containing protein | - |
M3L74_RS18535 (3674644) | 3674644..3675339 | - | 696 | WP_249018277.1 | fimbria/pilus periplasmic chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3656248..3682140 | 25892 | |
- | flank | IS/Tn | - | - | 3673406..3673783 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T244792 WP_003031349.1 NZ_CP097107:3670945-3671286 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |