Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3463220..3463840 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M3L74_RS17505 | Protein ID | WP_002892050.1 |
Coordinates | 3463622..3463840 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | M3L74_RS17500 | Protein ID | WP_003021733.1 |
Coordinates | 3463220..3463594 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS17490 (3458366) | 3458366..3459559 | + | 1194 | WP_088902653.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M3L74_RS17495 (3459582) | 3459582..3462731 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
M3L74_RS17500 (3463220) | 3463220..3463594 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
M3L74_RS17505 (3463622) | 3463622..3463840 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M3L74_RS17510 (3464022) | 3464022..3464573 | + | 552 | WP_044712836.1 | maltose O-acetyltransferase | - |
M3L74_RS17515 (3464690) | 3464690..3465160 | + | 471 | WP_003021724.1 | YlaC family protein | - |
M3L74_RS17520 (3465238) | 3465238..3465378 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
M3L74_RS17525 (3465380) | 3465380..3465640 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
M3L74_RS17530 (3465829) | 3465829..3467382 | + | 1554 | WP_044712838.1 | EAL domain-containing protein | - |
M3L74_RS17535 (3467434) | 3467434..3467787 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
M3L74_RS17540 (3467852) | 3467852..3468481 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244791 WP_002892050.1 NZ_CP097107:3463622-3463840 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT244791 WP_003021733.1 NZ_CP097107:3463220-3463594 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |