Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 645986..646640 | Replicon | chromosome |
Accession | NZ_CP097107 | ||
Organism | Citrobacter freundii strain GMU8049 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | M3L74_RS03630 | Protein ID | WP_003026936.1 |
Coordinates | 646233..646640 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | M3L74_RS03625 | Protein ID | WP_003026938.1 |
Coordinates | 645986..646252 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L74_RS03600 (641187) | 641187..642620 | - | 1434 | WP_088903082.1 | 6-phospho-beta-glucosidase BglA | - |
M3L74_RS03605 (642741) | 642741..643469 | - | 729 | WP_060855085.1 | MurR/RpiR family transcriptional regulator | - |
M3L74_RS03610 (643522) | 643522..643833 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
M3L74_RS03615 (643996) | 643996..644655 | + | 660 | WP_003838267.1 | hemolysin III family protein | - |
M3L74_RS03620 (644749) | 644749..645729 | - | 981 | WP_088903083.1 | tRNA-modifying protein YgfZ | - |
M3L74_RS03625 (645986) | 645986..646252 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
M3L74_RS03630 (646233) | 646233..646640 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
M3L74_RS03635 (646685) | 646685..647206 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
M3L74_RS03640 (647320) | 647320..648216 | + | 897 | WP_249018363.1 | site-specific tyrosine recombinase XerD | - |
M3L74_RS03645 (648240) | 648240..648953 | + | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M3L74_RS03650 (648959) | 648959..650692 | + | 1734 | WP_048232743.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T244785 WP_003026936.1 NZ_CP097107:646233-646640 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |