Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 434508..435187 Replicon chromosome
Accession NZ_CP097107
Organism Citrobacter freundii strain GMU8049

Toxin (Protein)


Gene name ykfI Uniprot ID A0A7D6Z078
Locus tag M3L74_RS02530 Protein ID WP_048215514.1
Coordinates 434846..435187 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A0F6RHY7
Locus tag M3L74_RS02525 Protein ID WP_046495841.1
Coordinates 434508..434825 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3L74_RS02485 (430067) 430067..430900 + 834 WP_103798307.1 DUF932 domain-containing protein -
M3L74_RS02490 (431102) 431102..431806 + 705 WP_103798306.1 WYL domain-containing protein -
M3L74_RS02495 (431803) 431803..432417 + 615 WP_046495819.1 hypothetical protein -
M3L74_RS02500 (432506) 432506..432916 + 411 WP_046495825.1 hypothetical protein -
M3L74_RS02505 (432994) 432994..433230 + 237 WP_046495830.1 DUF905 domain-containing protein -
M3L74_RS02510 (433309) 433309..433767 + 459 WP_046495834.1 antirestriction protein -
M3L74_RS02515 (433783) 433783..434259 + 477 WP_249018341.1 RadC family protein -
M3L74_RS02520 (434268) 434268..434489 + 222 WP_000691995.1 DUF987 domain-containing protein -
M3L74_RS02525 (434508) 434508..434825 + 318 WP_046495841.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M3L74_RS02530 (434846) 434846..435187 + 342 WP_048215514.1 TA system toxin CbtA family protein Toxin
M3L74_RS02535 (435303) 435303..436136 + 834 WP_046495848.1 DUF4942 domain-containing protein -
M3L74_RS02545 (436398) 436398..437411 - 1014 WP_181497821.1 tyrosine-type recombinase/integrase -
M3L74_RS02550 (437417) 437417..437962 - 546 WP_181497822.1 hypothetical protein -
M3L74_RS02555 (437986) 437986..438609 - 624 WP_181497882.1 phage repressor protein CI -
M3L74_RS02560 (438710) 438710..438946 + 237 WP_075606845.1 regulator -
M3L74_RS02565 (438981) 438981..439490 + 510 WP_249018342.1 phage regulatory CII family protein -
M3L74_RS02570 (439498) 439498..439698 + 201 WP_015386352.1 DUF2724 domain-containing protein -
M3L74_RS02575 (439662) 439662..440003 + 342 WP_249018343.1 DUF5347 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 430067..475615 45548


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(2-112)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13014.97 Da        Isoelectric Point: 10.4182

>T244784 WP_048215514.1 NZ_CP097107:434846-435187 [Citrobacter freundii]
MKPQSAATSRAVKPCLSPVAIWQILLTRLLEQHYGLTLNDTPFRDESVIQEHIDAGITLANAVNFLVEKYELVRIDRRRF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11869.49 Da        Isoelectric Point: 6.6245

>AT244784 WP_046495841.1 NZ_CP097107:434508-434825 [Citrobacter freundii]
MSNITWGLQRDITPRLGTRLVQEGNRLHYLADRASITGKFSDAECQKLDETFPHFISQMESMLTSGELNPLHVHCVTLYH
TGFTCEADTLGSCGYVYIAIYPTKR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6Z078

Antitoxin

Source ID Structure
AlphaFold DB A0A0F6RHY7

References