Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpB-mazE/PRK09812-ChpS |
| Location | 45044..45642 | Replicon | plasmid pNY11382-NR |
| Accession | NZ_CP097105 | ||
| Organism | Pseudomonas sp. NY11382 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A2V4KLX1 |
| Locus tag | M2J80_RS28595 | Protein ID | WP_023118080.1 |
| Coordinates | 45044..45397 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A6H1Q8V4 |
| Locus tag | M2J80_RS28600 | Protein ID | WP_009684309.1 |
| Coordinates | 45394..45642 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J80_RS28565 (M2J80_28555) | 40605..40922 | + | 318 | WP_110389097.1 | hypothetical protein | - |
| M2J80_RS28570 (M2J80_28560) | 41160..41576 | + | 417 | WP_033690668.1 | hypothetical protein | - |
| M2J80_RS28575 (M2J80_28565) | 41763..43109 | + | 1347 | WP_009684314.1 | replicative DNA helicase | - |
| M2J80_RS28580 (M2J80_28570) | 43136..43585 | + | 450 | WP_015026481.1 | hypothetical protein | - |
| M2J80_RS28585 (M2J80_28575) | 43822..44274 | + | 453 | WP_009684312.1 | hypothetical protein | - |
| M2J80_RS28590 (M2J80_28580) | 44325..45047 | - | 723 | WP_009684311.1 | hypothetical protein | - |
| M2J80_RS28595 (M2J80_28585) | 45044..45397 | - | 354 | WP_023118080.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2J80_RS28600 (M2J80_28590) | 45394..45642 | - | 249 | WP_009684309.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M2J80_RS28605 (M2J80_28595) | 45639..46058 | - | 420 | WP_033690665.1 | hypothetical protein | - |
| M2J80_RS28610 (M2J80_28600) | 46132..46608 | - | 477 | WP_023118079.1 | single-stranded DNA-binding protein | - |
| M2J80_RS28615 (M2J80_28605) | 46637..47056 | - | 420 | WP_009683787.1 | hypothetical protein | - |
| M2J80_RS28620 (M2J80_28610) | 47065..47748 | - | 684 | WP_009683788.1 | hypothetical protein | - |
| M2J80_RS28625 (M2J80_28615) | 47745..48281 | - | 537 | WP_009683789.1 | hypothetical protein | - |
| M2J80_RS28630 (M2J80_28620) | 48278..48508 | - | 231 | WP_009683790.1 | hypothetical protein | - |
| M2J80_RS28635 (M2J80_28625) | 48498..50573 | - | 2076 | WP_009683791.1 | DNA cytosine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..148732 | 148732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 12146.02 Da Isoelectric Point: 9.7603
>T244781 WP_023118080.1 NZ_CP097105:c45397-45044 [Pseudomonas sp. NY11382]
MSKRPQHQFDRGDIVSLDMGSASTQVACKALVLSPAAYNALGLALAVPITEHDSSRYAGFAVAIVLPGRTPASGAALVNL
VRPVDLAARGAKLLGKAPQTTIDEALQRLQAVVGKDQ
MSKRPQHQFDRGDIVSLDMGSASTQVACKALVLSPAAYNALGLALAVPITEHDSSRYAGFAVAIVLPGRTPASGAALVNL
VRPVDLAARGAKLLGKAPQTTIDEALQRLQAVVGKDQ
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V4KLX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H1Q8V4 |