Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2457072..2457619 | Replicon | chromosome |
| Accession | NZ_CP097102 | ||
| Organism | Halomonas venusta strain SND-01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3L73_RS12030 | Protein ID | WP_146945458.1 |
| Coordinates | 2457072..2457374 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3L73_RS12035 | Protein ID | WP_125748707.1 |
| Coordinates | 2457362..2457619 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3L73_RS12000 (M3L73_12000) | 2452709..2453197 | - | 489 | WP_125748685.1 | VOC family protein | - |
| M3L73_RS12005 (M3L73_12005) | 2453321..2454112 | - | 792 | WP_125748688.1 | type I methionyl aminopeptidase | - |
| M3L73_RS12010 (M3L73_12010) | 2454105..2454311 | - | 207 | WP_125748691.1 | ParD-like family protein | - |
| M3L73_RS12015 (M3L73_12015) | 2454489..2455703 | - | 1215 | WP_249016631.1 | crosslink repair DNA glycosylase YcaQ family protein | - |
| M3L73_RS12020 (M3L73_12020) | 2455795..2456199 | - | 405 | WP_146943706.1 | DUF1801 domain-containing protein | - |
| M3L73_RS12025 (M3L73_12025) | 2456282..2456869 | - | 588 | WP_198350352.1 | class I SAM-dependent methyltransferase | - |
| M3L73_RS12030 (M3L73_12030) | 2457072..2457374 | - | 303 | WP_146945458.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3L73_RS12035 (M3L73_12035) | 2457362..2457619 | - | 258 | WP_125748707.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M3L73_RS12040 (M3L73_12040) | 2457798..2457884 | - | 87 | Protein_2352 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| M3L73_RS12045 (M3L73_12045) | 2457990..2458811 | + | 822 | WP_249018217.1 | aldo/keto reductase | - |
| M3L73_RS12050 (M3L73_12050) | 2458990..2459673 | - | 684 | WP_249016632.1 | EamA family transporter | - |
| M3L73_RS12055 (M3L73_12055) | 2459670..2459894 | - | 225 | WP_249016633.1 | EamA family transporter | - |
| M3L73_RS12060 (M3L73_12060) | 2460063..2460944 | + | 882 | WP_022520598.1 | helix-turn-helix domain-containing protein | - |
| M3L73_RS12065 (M3L73_12065) | 2461090..2461275 | - | 186 | WP_249016634.1 | hypothetical protein | - |
| M3L73_RS12070 (M3L73_12070) | 2461352..2461546 | - | 195 | WP_249016635.1 | hypothetical protein | - |
| M3L73_RS12075 (M3L73_12075) | 2461534..2461821 | - | 288 | WP_249016636.1 | hypothetical protein | - |
| M3L73_RS12080 (M3L73_12080) | 2461888..2462163 | - | 276 | WP_249016637.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11649.34 Da Isoelectric Point: 4.4400
>T244777 WP_146945458.1 NZ_CP097102:c2457374-2457072 [Halomonas venusta]
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVQDVFDKTERLENFPRSGRIPPELPNSVYREIVVPPCRIFYREDEKQV
LILYVMREERQLRAYMLGNS
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVQDVFDKTERLENFPRSGRIPPELPNSVYREIVVPPCRIFYREDEKQV
LILYVMREERQLRAYMLGNS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|