Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 297663..298307 | Replicon | chromosome |
Accession | NZ_CP097102 | ||
Organism | Halomonas venusta strain SND-01 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | M3L73_RS01465 | Protein ID | WP_083001961.1 |
Coordinates | 298125..298307 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M3L73_RS01460 | Protein ID | WP_125746403.1 |
Coordinates | 297663..298082 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3L73_RS01430 (M3L73_01430) | 293034..293690 | + | 657 | WP_249017362.1 | S24 family peptidase | - |
M3L73_RS01435 (M3L73_01435) | 293687..294214 | + | 528 | WP_249017363.1 | hypothetical protein | - |
M3L73_RS01440 (M3L73_01440) | 294211..295398 | + | 1188 | WP_249017364.1 | DGQHR domain-containing protein | - |
M3L73_RS01445 (M3L73_01445) | 295410..296222 | - | 813 | WP_249017365.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
M3L73_RS01450 (M3L73_01450) | 296484..296981 | - | 498 | WP_249017366.1 | hypothetical protein | - |
M3L73_RS01455 (M3L73_01455) | 297184..297534 | + | 351 | WP_249017367.1 | hypothetical protein | - |
M3L73_RS01460 (M3L73_01460) | 297663..298082 | - | 420 | WP_125746403.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M3L73_RS01465 (M3L73_01465) | 298125..298307 | - | 183 | WP_083001961.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M3L73_RS01470 (M3L73_01470) | 298425..299390 | - | 966 | WP_249017368.1 | contractile injection system protein, VgrG/Pvc8 family | - |
M3L73_RS01475 (M3L73_01475) | 299393..299842 | - | 450 | WP_249017369.1 | phage tail protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 274628..326591 | 51963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6641.78 Da Isoelectric Point: 11.2210
>T244776 WP_083001961.1 NZ_CP097102:c298307-298125 [Halomonas venusta]
VNSRALIKELEADGWELVRVKGSHHHFRHPTKPGTVTVPHPKKDLKTGLVKGIRKSAGLL
VNSRALIKELEADGWELVRVKGSHHHFRHPTKPGTVTVPHPKKDLKTGLVKGIRKSAGLL
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15227.18 Da Isoelectric Point: 4.3899
>AT244776 WP_125746403.1 NZ_CP097102:c298082-297663 [Halomonas venusta]
MLFPIAIERGDEQHAYGVAVPDLPGCHSAGDTFEEAMTNAKEAIEGWLEVAVDFGDPIPEATSIEHHMDNPDFEGWIWAV
IDIDLTPYLGKSHKINVTLPDLLVKQIDDFVASHPGDKTRSGFLSRVAMAELAKARKSA
MLFPIAIERGDEQHAYGVAVPDLPGCHSAGDTFEEAMTNAKEAIEGWLEVAVDFGDPIPEATSIEHHMDNPDFEGWIWAV
IDIDLTPYLGKSHKINVTLPDLLVKQIDDFVASHPGDKTRSGFLSRVAMAELAKARKSA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|