Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 69349..69950 Replicon plasmid pEC258-2
Accession NZ_CP097097
Organism Escherichia coli strain 258E

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag HPY99_RS23310 Protein ID WP_001216045.1
Coordinates 69570..69950 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag HPY99_RS23305 Protein ID WP_001190712.1
Coordinates 69349..69570 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPY99_RS23275 (HPY99_23465) 64445..64624 + 180 Protein_64 hypothetical protein -
HPY99_RS23280 (HPY99_23470) 64723..65469 - 747 Protein_65 IS1 family transposase -
HPY99_RS23285 (HPY99_23475) 65695..67137 + 1443 WP_249232971.1 acyltransferase family protein -
HPY99_RS23290 (HPY99_23480) 68121..68495 - 375 Protein_67 integrase core domain-containing protein -
HPY99_RS23295 (HPY99_23485) 68473..68712 - 240 WP_223368633.1 hypothetical protein -
HPY99_RS23300 (HPY99_23490) 68887..69276 + 390 WP_000506730.1 S24 family peptidase -
HPY99_RS23305 (HPY99_23495) 69349..69570 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HPY99_RS23310 (HPY99_23500) 69570..69950 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HPY99_RS23315 (HPY99_23505) 69955..70134 + 180 WP_001339207.1 hypothetical protein -
HPY99_RS23320 (HPY99_23510) 70162..71205 + 1044 WP_023356283.1 DUF968 domain-containing protein -
HPY99_RS23325 (HPY99_23515) 71294..71746 + 453 WP_001326849.1 late promoter-activating protein -
HPY99_RS23330 (HPY99_23520) 71832..73025 + 1194 WP_000219625.1 hypothetical protein -
HPY99_RS23335 (HPY99_23525) 73025..74509 + 1485 WP_000124150.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..90559 90559
- flank IS/Tn - - 68121..68495 374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T244775 WP_001216045.1 NZ_CP097097:69570-69950 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT244775 WP_001190712.1 NZ_CP097097:69349-69570 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References