Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 156726..157276 | Replicon | chromosome |
Accession | NZ_CP097093 | ||
Organism | MAG: Mogibacterium diversum isolate JCVI-JB-Md32 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M3I20_RS00685 | Protein ID | WP_273451619.1 |
Coordinates | 156995..157276 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M3I20_RS00680 | Protein ID | WP_273451617.1 |
Coordinates | 156726..156998 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I20_RS00665 (M3I20_00670) | 152351..153199 | + | 849 | WP_273451611.1 | DUF1963 domain-containing protein | - |
M3I20_RS00670 (M3I20_00675) | 153250..153735 | + | 486 | WP_273451613.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
M3I20_RS00675 (M3I20_00680) | 154001..156580 | + | 2580 | WP_273451615.1 | FctA domain-containing protein | - |
M3I20_RS00680 (M3I20_00685) | 156726..156998 | + | 273 | WP_273451617.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3I20_RS00685 (M3I20_00690) | 156995..157276 | + | 282 | WP_273451619.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
M3I20_RS00690 (M3I20_00695) | 157299..157988 | - | 690 | WP_273451621.1 | TraX family protein | - |
M3I20_RS00695 (M3I20_00700) | 158055..159080 | - | 1026 | WP_106057918.1 | Cna B-type domain-containing protein | - |
M3I20_RS00700 (M3I20_00705) | 159492..161195 | + | 1704 | WP_273451624.1 | isopeptide-forming domain-containing fimbrial protein | - |
M3I20_RS00705 (M3I20_00710) | 161296..162177 | + | 882 | WP_273451626.1 | class C sortase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10804.68 Da Isoelectric Point: 9.9845
>T244767 WP_273451619.1 NZ_CP097093:156995-157276 [Mogibacterium diversum]
MKYSIKFTSQFKKDLKLAKKQGKNLNKLFEVVDALATGKTLEAKYRDHNLSGKYSATRECHIEPDWLLVYEIIDESLVLI
LYRIGSHAKLFKL
MKYSIKFTSQFKKDLKLAKKQGKNLNKLFEVVDALATGKTLEAKYRDHNLSGKYSATRECHIEPDWLLVYEIIDESLVLI
LYRIGSHAKLFKL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|