Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 206764..207434 | Replicon | plasmid pKP130-1 |
| Accession | NZ_CP097083 | ||
| Organism | Klebsiella pneumoniae strain KP130 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | M3I82_RS26330 | Protein ID | WP_004213072.1 |
| Coordinates | 206764..207207 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | M3I82_RS26335 | Protein ID | WP_004213073.1 |
| Coordinates | 207204..207434 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I82_RS26295 (M3I82_26270) | 202174..202449 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| M3I82_RS26300 (M3I82_26275) | 202512..203003 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| M3I82_RS26305 (M3I82_26280) | 203052..203972 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| M3I82_RS26310 (M3I82_26285) | 204063..204466 | + | 404 | Protein_223 | GAF domain-containing protein | - |
| M3I82_RS26315 (M3I82_26290) | 204984..205620 | - | 637 | Protein_224 | mucoid phenotype regulator RmpA2 | - |
| M3I82_RS26320 (M3I82_26295) | 206037..206341 | + | 305 | Protein_225 | transposase | - |
| M3I82_RS26325 (M3I82_26300) | 206364..206615 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| M3I82_RS26330 (M3I82_26305) | 206764..207207 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3I82_RS26335 (M3I82_26310) | 207204..207434 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3I82_RS26340 (M3I82_26315) | 208042..209175 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| M3I82_RS26345 (M3I82_26320) | 209191..209484 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| M3I82_RS26350 (M3I82_26325) | 209474..209680 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| M3I82_RS26355 (M3I82_26330) | 210032..210322 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| M3I82_RS26360 (M3I82_26335) | 210312..211211 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226565 | 226565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T244766 WP_004213072.1 NZ_CP097083:c207207-206764 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|