Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 169429..170165 | Replicon | plasmid pKP130-1 |
| Accession | NZ_CP097083 | ||
| Organism | Klebsiella pneumoniae strain KP130 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | M3I82_RS26110 | Protein ID | WP_004098919.1 |
| Coordinates | 169683..170165 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | M3I82_RS26105 | Protein ID | WP_004213599.1 |
| Coordinates | 169429..169695 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I82_RS26080 (M3I82_26055) | 164661..165218 | + | 558 | WP_004213590.1 | recombinase family protein | - |
| M3I82_RS26085 (M3I82_26060) | 165221..168190 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| M3I82_RS26090 (M3I82_26065) | 168232..168726 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| M3I82_RS26095 (M3I82_26070) | 168787..168990 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| M3I82_RS26100 (M3I82_26075) | 169004..169234 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| M3I82_RS26105 (M3I82_26080) | 169429..169695 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| M3I82_RS26110 (M3I82_26085) | 169683..170165 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| M3I82_RS26115 (M3I82_26090) | 170586..171813 | + | 1228 | Protein_184 | IS3 family transposase | - |
| M3I82_RS26120 (M3I82_26095) | 171809..172204 | - | 396 | Protein_185 | IS3 family transposase | - |
| M3I82_RS26125 (M3I82_26100) | 172379..173401 | - | 1023 | WP_131079334.1 | porphobilinogen synthase | - |
| M3I82_RS26130 (M3I82_26105) | 173465..174811 | - | 1347 | WP_011154555.1 | dihydroorotase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226565 | 226565 | |
| - | inside | IScluster/Tn | - | - | 164661..171813 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T244765 WP_004098919.1 NZ_CP097083:169683-170165 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |