Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 86829..87739 Replicon plasmid pKP130-1
Accession NZ_CP097083
Organism Klebsiella pneumoniae strain KP130

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag M3I82_RS25670 Protein ID WP_004026354.1
Coordinates 87269..87739 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag M3I82_RS25665 Protein ID WP_004026357.1
Coordinates 86829..87272 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I82_RS25635 (M3I82_25615) 81847..82368 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
M3I82_RS25640 (M3I82_25620) 82365..83318 + 954 Protein_89 fec operon regulator FecR -
M3I82_RS25645 (M3I82_25625) 83405..85531 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
M3I82_RS25650 (M3I82_25630) 85606..85731 + 126 Protein_91 Fe3+-citrate ABC transporter substrate-binding protein -
M3I82_RS25655 (M3I82_25635) 85906..86127 + 222 WP_004213643.1 DUF2188 domain-containing protein -
M3I82_RS25660 (M3I82_25640) 86225..86728 + 504 Protein_93 DUF4113 domain-containing protein -
M3I82_RS25665 (M3I82_25645) 86829..87272 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
M3I82_RS25670 (M3I82_25650) 87269..87739 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
M3I82_RS25675 (M3I82_25655) 88194..88382 - 189 WP_223271245.1 hypothetical protein -
M3I82_RS25680 (M3I82_25660) 88996..89256 - 261 WP_004026352.1 hypothetical protein -
M3I82_RS25685 (M3I82_25665) 89827..91012 - 1186 Protein_98 IS481 family transposase -
M3I82_RS25690 (M3I82_25670) 91084..91242 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
M3I82_RS25695 (M3I82_25675) 91621..91863 - 243 WP_071826037.1 hypothetical protein -
M3I82_RS25700 (M3I82_25680) 91939..92103 - 165 WP_011154586.1 hypothetical protein -
M3I82_RS25705 (M3I82_25685) 92220..92381 - 162 WP_164507110.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 1..226565 226565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T244764 WP_004026354.1 NZ_CP097083:87269-87739 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT244764 WP_004026357.1 NZ_CP097083:86829-87272 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References