Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 23661..24412 | Replicon | plasmid pKP130-1 |
Accession | NZ_CP097083 | ||
Organism | Klebsiella pneumoniae strain KP130 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | M3I82_RS25315 | Protein ID | WP_004902249.1 |
Coordinates | 23661..24143 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | M3I82_RS25320 | Protein ID | WP_004902250.1 |
Coordinates | 24134..24412 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I82_RS25295 (M3I82_25275) | 20060..20707 | - | 648 | WP_014386537.1 | EcsC family protein | - |
M3I82_RS25300 (M3I82_25280) | 20734..21489 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
M3I82_RS25305 (M3I82_25285) | 21590..21982 | - | 393 | WP_045145491.1 | hypothetical protein | - |
M3I82_RS25310 (M3I82_25290) | 22087..22626 | - | 540 | WP_004902239.1 | hypothetical protein | - |
M3I82_RS25315 (M3I82_25295) | 23661..24143 | - | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
M3I82_RS25320 (M3I82_25300) | 24134..24412 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
M3I82_RS25325 (M3I82_25305) | 24531..24743 | - | 213 | WP_266051389.1 | hypothetical protein | - |
M3I82_RS25330 (M3I82_25310) | 24851..25192 | - | 342 | WP_004902257.1 | hypothetical protein | - |
M3I82_RS25335 | 25785..25931 | - | 147 | Protein_28 | DUF2235 domain-containing protein | - |
M3I82_RS25340 (M3I82_25320) | 25966..26076 | + | 111 | Protein_29 | glutathione ABC transporter permease GsiC | - |
M3I82_RS25345 (M3I82_25325) | 26160..27830 | - | 1671 | WP_004902261.1 | AMP-binding protein | - |
M3I82_RS25350 (M3I82_25330) | 27811..29076 | - | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
M3I82_RS25355 (M3I82_25335) | 29094..29384 | - | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226565 | 226565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T244763 WP_004902249.1 NZ_CP097083:c24143-23661 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|