Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4589281..4589984 | Replicon | chromosome |
| Accession | NZ_CP097082 | ||
| Organism | Klebsiella pneumoniae strain KP130 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | M3I82_RS22205 | Protein ID | WP_048261918.1 |
| Coordinates | 4589281..4589622 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | M3I82_RS22210 | Protein ID | WP_063308407.1 |
| Coordinates | 4589643..4589984 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I82_RS22175 (4584497) | 4584497..4585171 | + | 675 | WP_004152211.1 | hypothetical protein | - |
| M3I82_RS22180 (4585173) | 4585173..4585520 | + | 348 | WP_004199257.1 | hypothetical protein | - |
| M3I82_RS22185 (4585523) | 4585523..4586002 | + | 480 | WP_002887049.1 | type VI secretion system tube protein TssD | - |
| M3I82_RS22190 (4586194) | 4586194..4586517 | - | 324 | Protein_4347 | hypothetical protein | - |
| M3I82_RS22195 (4586536) | 4586536..4587647 | - | 1112 | Protein_4348 | IS3 family transposase | - |
| M3I82_RS22200 (4588015) | 4588015..4589022 | - | 1008 | WP_038422858.1 | restriction endonuclease | - |
| M3I82_RS22205 (4589281) | 4589281..4589622 | - | 342 | WP_048261918.1 | TA system toxin CbtA family protein | Toxin |
| M3I82_RS22210 (4589643) | 4589643..4589984 | - | 342 | WP_063308407.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M3I82_RS22215 (4589995) | 4589995..4590537 | - | 543 | WP_117247367.1 | DNA repair protein RadC | - |
| M3I82_RS22220 (4590550) | 4590550..4590990 | - | 441 | WP_117247366.1 | antirestriction protein | - |
| M3I82_RS22225 (4591022) | 4591022..4591843 | - | 822 | WP_117247365.1 | DUF932 domain-containing protein | - |
| M3I82_RS22230 (4591944) | 4591944..4592174 | - | 231 | WP_131079338.1 | DUF905 domain-containing protein | - |
| M3I82_RS22235 (4592246) | 4592246..4592695 | - | 450 | WP_117247363.1 | IrmA family protein | - |
| M3I82_RS22240 (4592692) | 4592692..4593144 | - | 453 | WP_117247362.1 | hypothetical protein | - |
| M3I82_RS22245 (4593181) | 4593181..4593750 | - | 570 | WP_117247361.1 | hypothetical protein | - |
| M3I82_RS22250 (4593750) | 4593750..4594454 | - | 705 | WP_014226755.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4585173..4619817 | 34644 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12750.69 Da Isoelectric Point: 8.0324
>T244759 WP_048261918.1 NZ_CP097082:c4589622-4589281 [Klebsiella pneumoniae]
MKTLPATTPQAATLCLSPVTVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWEEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATTPQAATLCLSPVTVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWEEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|