Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3957208..3957827 | Replicon | chromosome |
| Accession | NZ_CP097082 | ||
| Organism | Klebsiella pneumoniae strain KP130 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M3I82_RS19150 | Protein ID | WP_002892050.1 |
| Coordinates | 3957609..3957827 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M3I82_RS19145 | Protein ID | WP_002892066.1 |
| Coordinates | 3957208..3957582 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I82_RS19135 (3952360) | 3952360..3953553 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M3I82_RS19140 (3953576) | 3953576..3956722 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M3I82_RS19145 (3957208) | 3957208..3957582 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M3I82_RS19150 (3957609) | 3957609..3957827 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M3I82_RS19155 (3957986) | 3957986..3958552 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M3I82_RS19160 (3958524) | 3958524..3958664 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M3I82_RS19165 (3958685) | 3958685..3959155 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M3I82_RS19170 (3959130) | 3959130..3960581 | - | 1452 | WP_004177237.1 | PLP-dependent aminotransferase family protein | - |
| M3I82_RS19175 (3960682) | 3960682..3961380 | + | 699 | WP_004177238.1 | GNAT family protein | - |
| M3I82_RS19180 (3961377) | 3961377..3961517 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M3I82_RS19185 (3961517) | 3961517..3961780 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244757 WP_002892050.1 NZ_CP097082:3957609-3957827 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244757 WP_002892066.1 NZ_CP097082:3957208-3957582 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |