Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 193565..194301 | Replicon | plasmid pKP131-1 |
Accession | NZ_CP097080 | ||
Organism | Klebsiella pneumoniae strain KP131 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | M3I83_RS26280 | Protein ID | WP_004098919.1 |
Coordinates | 193565..194047 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | M3I83_RS26285 | Protein ID | WP_004213599.1 |
Coordinates | 194035..194301 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I83_RS26260 (M3I83_26235) | 188919..190265 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
M3I83_RS26265 (M3I83_26240) | 190329..191351 | + | 1023 | WP_131079334.1 | porphobilinogen synthase | - |
M3I83_RS26270 (M3I83_26245) | 191526..191921 | + | 396 | Protein_215 | IS3 family transposase | - |
M3I83_RS26275 (M3I83_26250) | 191917..193144 | - | 1228 | Protein_216 | IS3 family transposase | - |
M3I83_RS26280 (M3I83_26255) | 193565..194047 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
M3I83_RS26285 (M3I83_26260) | 194035..194301 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
M3I83_RS26290 (M3I83_26265) | 194496..194726 | - | 231 | WP_004213598.1 | hypothetical protein | - |
M3I83_RS26295 (M3I83_26270) | 194740..194943 | - | 204 | WP_004213596.1 | HHA domain-containing protein | - |
M3I83_RS26300 (M3I83_26275) | 195004..195498 | - | 495 | WP_004213594.1 | hypothetical protein | - |
M3I83_RS26305 (M3I83_26280) | 195540..198509 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
M3I83_RS26310 (M3I83_26285) | 198512..199069 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..226558 | 226558 | |
- | inside | IScluster/Tn | - | - | 191917..199069 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T244748 WP_004098919.1 NZ_CP097080:c194047-193565 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |