Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 112751..113502 | Replicon | plasmid pKP131-1 |
Accession | NZ_CP097080 | ||
Organism | Klebsiella pneumoniae strain KP131 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | M3I83_RS25840 | Protein ID | WP_004902249.1 |
Coordinates | 113020..113502 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | M3I83_RS25835 | Protein ID | WP_004902250.1 |
Coordinates | 112751..113029 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I83_RS25800 (M3I83_25775) | 107779..108069 | + | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
M3I83_RS25805 (M3I83_25780) | 108087..109352 | + | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
M3I83_RS25810 (M3I83_25785) | 109333..111003 | + | 1671 | WP_004902261.1 | AMP-binding protein | - |
M3I83_RS25815 (M3I83_25790) | 111087..111197 | - | 111 | Protein_124 | glutathione ABC transporter permease GsiC | - |
M3I83_RS25820 | 111232..111378 | + | 147 | Protein_125 | DUF2235 domain-containing protein | - |
M3I83_RS25825 (M3I83_25800) | 111971..112312 | + | 342 | WP_004902257.1 | hypothetical protein | - |
M3I83_RS25830 (M3I83_25805) | 112420..112632 | + | 213 | WP_266051389.1 | hypothetical protein | - |
M3I83_RS25835 (M3I83_25810) | 112751..113029 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
M3I83_RS25840 (M3I83_25815) | 113020..113502 | + | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
M3I83_RS25845 (M3I83_25820) | 114537..115076 | + | 540 | WP_004902239.1 | hypothetical protein | - |
M3I83_RS25850 (M3I83_25825) | 115181..115573 | + | 393 | WP_045145491.1 | hypothetical protein | - |
M3I83_RS25855 (M3I83_25830) | 115674..116429 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
M3I83_RS25860 (M3I83_25835) | 116456..117103 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..226558 | 226558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T244746 WP_004902249.1 NZ_CP097080:113020-113502 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|