Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 49430..50340 Replicon plasmid pKP131-1
Accession NZ_CP097080
Organism Klebsiella pneumoniae strain KP131

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag M3I83_RS25485 Protein ID WP_004026354.1
Coordinates 49430..49900 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag M3I83_RS25490 Protein ID WP_004026357.1
Coordinates 49897..50340 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I83_RS25450 (M3I83_25425) 44792..44953 + 162 WP_164507110.1 hypothetical protein -
M3I83_RS25455 (M3I83_25430) 45070..45234 + 165 WP_011154586.1 hypothetical protein -
M3I83_RS25460 (M3I83_25435) 45310..45552 + 243 WP_071826037.1 hypothetical protein -
M3I83_RS25465 (M3I83_25440) 45931..46089 - 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
M3I83_RS25470 (M3I83_25445) 46161..47342 + 1182 WP_004883380.1 IS481 family transposase -
M3I83_RS25475 (M3I83_25450) 47913..48173 + 261 WP_004026352.1 hypothetical protein -
M3I83_RS25480 (M3I83_25455) 48787..48975 + 189 WP_223271245.1 hypothetical protein -
M3I83_RS25485 (M3I83_25460) 49430..49900 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
M3I83_RS25490 (M3I83_25465) 49897..50340 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
M3I83_RS25495 (M3I83_25470) 50441..50944 - 504 Protein_60 DUF4113 domain-containing protein -
M3I83_RS25500 (M3I83_25475) 51042..51263 - 222 WP_004213643.1 DUF2188 domain-containing protein -
M3I83_RS25505 (M3I83_25480) 51438..51563 - 126 Protein_62 Fe3+-citrate ABC transporter substrate-binding protein -
M3I83_RS25510 (M3I83_25485) 51638..53764 - 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
M3I83_RS25515 (M3I83_25490) 53851..54804 - 954 Protein_64 fec operon regulator FecR -
M3I83_RS25520 (M3I83_25495) 54801..55322 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA 1..226558 226558
- flank IS/Tn - - 46161..47342 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T244745 WP_004026354.1 NZ_CP097080:c49900-49430 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT244745 WP_004026357.1 NZ_CP097080:c50340-49897 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References