Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4589158..4589861 Replicon chromosome
Accession NZ_CP097079
Organism Klebsiella pneumoniae strain KP131

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag M3I83_RS22205 Protein ID WP_048261918.1
Coordinates 4589158..4589499 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag M3I83_RS22210 Protein ID WP_063308407.1
Coordinates 4589520..4589861 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I83_RS22175 (4584374) 4584374..4585048 + 675 WP_004152211.1 hypothetical protein -
M3I83_RS22180 (4585050) 4585050..4585397 + 348 WP_004199257.1 hypothetical protein -
M3I83_RS22185 (4585400) 4585400..4585879 + 480 WP_002887049.1 type VI secretion system tube protein TssD -
M3I83_RS22190 (4586071) 4586071..4586394 - 324 Protein_4347 hypothetical protein -
M3I83_RS22195 (4586413) 4586413..4587524 - 1112 Protein_4348 IS3 family transposase -
M3I83_RS22200 (4587892) 4587892..4588899 - 1008 WP_038422858.1 restriction endonuclease -
M3I83_RS22205 (4589158) 4589158..4589499 - 342 WP_048261918.1 TA system toxin CbtA family protein Toxin
M3I83_RS22210 (4589520) 4589520..4589861 - 342 WP_063308407.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M3I83_RS22215 (4589872) 4589872..4590414 - 543 WP_117247367.1 DNA repair protein RadC -
M3I83_RS22220 (4590427) 4590427..4590867 - 441 WP_117247366.1 antirestriction protein -
M3I83_RS22225 (4590899) 4590899..4591720 - 822 WP_117247365.1 DUF932 domain-containing protein -
M3I83_RS22230 (4591821) 4591821..4592051 - 231 WP_131079338.1 DUF905 domain-containing protein -
M3I83_RS22235 (4592123) 4592123..4592572 - 450 WP_117247363.1 IrmA family protein -
M3I83_RS22240 (4592569) 4592569..4593021 - 453 WP_117247362.1 hypothetical protein -
M3I83_RS22245 (4593058) 4593058..4593627 - 570 WP_117247361.1 hypothetical protein -
M3I83_RS22250 (4593627) 4593627..4594331 - 705 WP_014226755.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4585050..4619694 34644


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(13-111)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12750.69 Da        Isoelectric Point: 8.0324

>T244741 WP_048261918.1 NZ_CP097079:c4589499-4589158 [Klebsiella pneumoniae]
MKTLPATTPQAATLCLSPVTVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWEEQSPYLRAVDILRARQATGLLKRNRISAAR

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12722.34 Da        Isoelectric Point: 6.4739

>AT244741 WP_063308407.1 NZ_CP097079:c4589861-4589520 [Klebsiella pneumoniae]
MKSTDSENDSFLQWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTHR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References